PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000124.1.g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family FAR1
Protein Properties Length: 907aa    MW: 103942 Da    PI: 8.6421
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000124.1.g00003.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1767.7e-2458143290
                            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtk 80 
                                      Yn+YA ++GFsvr+ k++k  +n  + k +f Csk+g++e+++ + e+++  + +trtgC+a+++ +k+ d+ w v++
  FANhyb_rscf00000124.1.g00003.1  58 LYNSYAIRLGFSVRRGKKRKDAKN-VVRKINFLCSKQGFPEDDDPS-ETKKADKLSTRTGCQAMIRFTKT-DDMWTVSD 133
                                     7****************9999555.5****************9999.99999*****************9.9******* PP

                            FAR1  81 leleHnHela 90 
                                     ++ eHnH++a
  FANhyb_rscf00000124.1.g00003.1 134 FHPEHNHKFA 143
                                     *******986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.0E-2158143IPR004330FAR1 DNA binding domain
PfamPF105511.4E-31265357IPR018289MULE transposase domain
PROSITE profilePS5096611.127545581IPR007527Zinc finger, SWIM-type
PfamPF044341.4E-7548579IPR007527Zinc finger, SWIM-type
SMARTSM005751.5E-8556583IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 907 aa     Download sequence    Send to blast
MKTLKREKRP TVIDVDSEDE INGSNNQEEP TVVNRQERSD EDNLLGMMVH SESEAFELYN  60
SYAIRLGFSV RRGKKRKDAK NVVRKINFLC SKQGFPEDDD PSETKKADKL STRTGCQAMI  120
RFTKTDDMWT VSDFHPEHNH KFAKPEERQY LRSNKNLSEA HKGVIKTMKD ARIGTMKAYS  180
YLAEEVGGSQ NVGFTKRDCY NFVNKEKMAM FEAGDAQSLI NLFKRKQTED PMFFYSVQVD  240
QENRMTNFFW RDGRSRLDYE CFGDVVVFDT TYRTNRYNMI CAPFVGISNH WKNVLFGCAF  300
LLDETTTSFK WLFETFLESM GNQPPRTIYT DQCPAMANGI RDVFPDTCHR LCLWHISLNA  360
TRNIASYLGI PDFKKMFNKC LYACETVEEF QSKWDELLIT FNVTENSWLK KLYTLREKWC  420
AAFSLDTFSA GIQSSQRSES TNRVFHHISA ARMRLIEFVQ HYDKQLEATR SSDLEETFRC  480
TNGIPSSAKR STKLLYHAGE VYSRKVYNLF GTELAASMAF KMVEVDTNET VHTFELSREG  540
RNIIYVVKVN SSNDTITCSC KKFESKGLLC RHALRVLNVR NVTKIPPQYV LKRWKKDAKS  600
EIGAQEHEAL LQQKDKPSIA LRRNNMIRKA YDILSTAALT EKGCKIAMEK LKEMKELIEK  660
DEAESNGSGN KENNEALNDD SISDDNESDH QVDNTPILDP PCAKTKGMSN ERWKSTVEKR  720
NKNASKNTVS SSKKGDSEKQ QKGRSSKDPF SSSKKVLNTY SRYHAQYNSS NPYPIPMSTQ  780
FHPTMNLSAI NTPVCLPPSN QIPYDSTSFN SLNVLRSTSK TDQIGFDSMA FYQPNSTFTS  840
MLLGQHTSGS TSAPNHQVGL YPQPSQGLHS MTKQQQQGSR DMPYYLQQQS STNMPYYLQQ  900
QGSRDMP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17076RRGKKRK
27077RRGKKRKD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008353320.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLM5X4770.0M5X477_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-115FAR1-related sequence 5